Prof. João Carlos Setubal - Instituto de Quí­mica- ?· Noções da escala do mundo ... DNA fita dupla:…

Embed Size (px)

Text of Prof. João Carlos Setubal - Instituto de Quí­mica- ?· Noções da escala do mundo ... DNA fita...

  • Introduo Biologia Molecular

    QBQ 102 Aula 1 (biomol)

    Prof. Joo Carlos Setubal

  • Aulas de biologia molecular

    Junho Tera 2 (lab 1)

    Tera 9 (lab 2)

    Sexta 12

    Tera 16

    Sexta 19

    Tera 23

    Sexta 26

    Tera 30: PROVA

    Julho Sexta 3: PROVA SUBS

  • Site desta parte da disciplina

    http://www.iq.usp.br/setubal/qbq102/2015

    Tudo que preciso saber est no material disponibilizado neste site

    (PDFs e filminhos do YouTube)

    http://www.iq.usp.br/setubal/qbq102/2015

  • Formato desta parte da disciplina

    Aulas expositivas de aprox. 2 horas, com um intervalo de 10 minutos

    Aps a aula, estarei disposio para responder dvidas

    bom fazer perguntas em aula; em prova no possvel responder

    Para falar comigo fora da aula: marcar hora, mandando email para setubal@iq.usp.br

  • O que vou cobrar em prova?

    Consultar lista de questes no site

    So questes genricas; na prova haver questes mais especficas

    Exemplos

    Genrica: O que transcrio?

    Especfica: o que faz a principal enzima no processo de transcrio?

    A ideia que vocs aprendam os conceitos e os processos; sem decoreba!

  • O que biologia molecular?

    Estudo da vida ao nvel das molculas

    DNA

    RNA

    protenas

  • Por que aprender biologia molecular?

    a base comum de todos os seres vivos do planeta

    http://magazine.ufl.edu/2011/02/web-of-life/

  • Biologia molecular um elemento importante de uma formao abrangente

    Educao fsica e esportes

    Lida com o ser humano

    Cada vez mais a biologia molecular importante para o entendimento do ser humano, especialmente no seu aspecto fsico

  • O mundo das molculas

    Qual a escala?

    Quais so as foras dominantes?

    Qual a consistncia dos objetos?

    Como se d o movimento dos objetos?

  • Noes da escala do mundo molecular

    Iremos estudar molculas

    Que tamanho tem elas?

  • Vista lateral do macio do Pico do Marins

    Foto: Jurandir Lima/ Trilhas &Trilhas

    Uma montanha ~1000 vezes maior do que uma pessoa

  • A Terra ~1000 vezes maior do que uma montanha

  • Portanto uma pessoa ~1 milho de vezes menor que a Terra

  • Clulas e molculas

    Uma clula ~1000 vezes menor do que uma pessoa

    Uma molcula ~1000 vezes menor do que uma clula

    Portanto

    Ns estamos para a Terra assim como

    as molculas esto para ns

  • As foras que operam numa escala molecular so diferentes ds que operam na nossa escala

    Nossa escala

    Gravidade, atrito

    Escala molecular

    Atrao e repulso entre tomos

  • Consistncia das molculas

    Podemos tratar as molculas como se fossem objetos slidos, tais como blocos e esferas slidos

    Propriedade importante:

    Molculas podem se encaixar umas nas outras como chaves em fechaduras

  • Movimento molecular

    predominantemente aleatrio (sujeito s foras j mencionadas)

    No h controle central e muito menos vontade prpria

    As molculas dentro de uma clula esto continuamente colidindo umas nas outras

  • Apesar de aleatrio, o movimento rpido (fraes de segundo)

  • Imagens de David Goodsell

  • http://www.scientificamerican.com/article.cfm?id=are-there-missing-pieces

    DNA

  • O que DNA?

    Nome: cido desoxiribonucleico

    uma macromolcula

    Onde? Dentro do ncleo de cada clula

    Estrutura de fita dupla

    Em espiral (ou hlice)

  • DNA tem uma espinha dorsal que um acar (desoxiribose) O que varia ao longo da cadeia so as bases ligadas s molculas de acar

  • Hlice dupla do DNA

    28

  • Ligaes (Pontes) de Hidrognio entre pares de bases de cadeias opostas Interaes hidrofbicas e de van der Waals entre bases adjacentes (na mesma cadeia)

    DNA fita dupla: cadeias antiparalelas

    T A

    T

    C G

  • DNA fita dupla: cadeias antiparalelas

    Adenina

    Timina

    Guanina

    Citosina

    Ligaes (Pontes) de Hidrognio entre pares de bases

  • Desoxirribonucleotdeo

    Fosfato

    DNA

    Desoxir-

    ribose

    Ligao glicosdica

    Projeo de Haworth

  • Existe tambm RNA

    cido ribonucleico

  • Ribonucleotdeo

    Fosfato

    Ribose

    RNA

  • Bases ou (ribo)nucleotdeos

    Adenina

    Guanina

    Citosina

    Timina (Uracil em RNA) pirimidinas

  • Purinas

    Adenina Guanina

  • Pirimidinas

    Citosina Timina (DNA)

    Uracila (RNA)

  • DNA e RNA

    http://cyberbridge.mcb.harvard.edu/dna_3.html

  • RNA

    Geralmente est em fita simples, ou tem apenas pequenos trechos em fita dupla

    http://cyberbridge.mcb.harvard.edu/dna_3.html

  • A e U no se ligam to fortemente quanto A e T; por isso que RNA fita simples ou tem apenas trechos em que se liga a si mesmo

  • 34 angstrons

    1 angstrom = 1 x 10-10 m

  • Se 1 angstrom = 1 mm

    Um cromossomo de 100.000.000 bp teria 340 km de comprimento

  • DNA tem vida longa

    Meia-vida: tempo para que metade das ligaes de uma molcula se quebre

    521 anos [Allentoft, Bunce et al. 2012]

    J foi possvel extrair DNA (fragmentado) de amostras congeladas com 500 mil anos

    Mximo estimado: at 1,5 milhes de anos

    No d para recuperar DNA de dinossauros

    Extintos h 65 milhes de anos

  • AGCTCGCGCTCCGCATCCATCCAGTAGGGTTCGGTGTCGACGAGCGTGCC

    GTCCATATCCCAGAAGACGGCGGCCGGCATCGCGTGCGGAGTCAGTTCGG

    TCACGGCTGACAAGTCTATCCCGGCGGCCCCGGGCCTATTCTTGAGGGAC

    GGCGTCCTGACCGGTCGCCGGATGAAAGGACCAGAACGCCCCGTGACTGA

    CGCGAACAGCATCCTCGGAGGGCGCATCCTCGTGGTGGCCTTCGAAGGGT

    GGAACGACGCTGGCGAGGCCGCCAGCGGGGCCGTCAAGACGCTCAAGGAC

    CAGCTGGATGTCGTCCCGGTCGCCGAGGTCGATCCCGAGCTGTACTTCGA

    CTTCCAGTTCAACCGGCCGGTCGTCGCGGACGACGACGGCCGCCGGCGCC

    TCATCTGGCCGTCCGCGGAGATCCTGGGCCCAGCTCGCCCCGGCGACACC

    GGCGATGCGCGCCTGGACGCCACCGGCGCCAACGCGGGCAATATCTTCCT

    TCTCCTCGGCACCGAGCCGTCGCGCAGCTGGCGCAGCTTCACCGCGGAGA

    TCATGGATGCGGCCCTGGCCTCCGACATCGGCGCCATCGTCTTCCTCGGT

    GCGATGCTGGCGGACGTACCGCACACCCGCCCCATCTCCATCTTCGCTTC

    GAGCGAGAACGCGGCCGTCCGTGCGGAGCTCGGCATCGAACGCTCTTCGT

    ACGAGGGGCCGGTCGGTATCCTGAGCGCGCTCGCCGAAGGGGCGGAGGAC

    GTGGGCATTCCGACCATCTCCATCTGGGCGTCGGTTCCGCACTATGTCCA

    CAATGCGCCCAGCCCGAAGGCGGTGCTCGCACTGATCGACAAGCTCGAAG

    AGCTGGTGAATGTCACCATCCCGCGTGGCTCGCTGGTGGAGGAGGCCACG

    GCCTGGGAAGCCGGGATCGACGCGCTGGCTCTGGACGACGACGAGATGGC

    TACGTACATCCAGCAGCTGGAGCAGGCACGCGACACCGTGGACTCCCCTG

    AGGCCAGCGGCGAGGCGATCGCCCAGGAGTTCGAGCGCTACCTCCGCCGC

    CGCGACGGCCGCGCCGGCGATGACCCCCGCCGTGGCTGACGTCACCCCCT

    CTCTGCGTCCGCCGTCCTCTGTTCCCCCCGCTCGGCCTCCCCTGAGGCCG

    AGGAGTCGCGCCCACATGCCGGAAACTCCTCCTTTCCTGACTTTCTGGAG

    Representao de uma sequncia de DNA

    45

  • Complemento reverso

    Conveno

    Contedo de uma das fitas do DNA deve ser representado como uma cadeia de letras para ser lida da esquerda para a direita (5 3)

    Dada uma das fitas, possvel saber a outra fita

    Complementar e inverter

  • Complemento reverso

    ATGGTCTC

    Qual a outra fita?

    Complementar

    TACCAGAG

    Inverter

    GAGACCAT

  • ATGGTCTC

    TACCAGAG

    5 3

    3 5

  • Exerccio

    Escreva uma cadeia de DNA com pelo menos 6 bases, usando pelo menos 1 vez cada base, tal que o complemento reverso dela ela mesma

  • Palndromos

    Socorram-me Subi no nibus em Marrocos

    Rir o breve verbo rir

  • Palndromos biolgicos ocorrem em genomas

    Eles tem funo biolgica

  • Mas o que genoma?

    o DNA contido numa clula

    Mas para que serve o genoma?

    Para codificar genes

  • 53

  • Genes e protenas

    > DNA sequence

    AATTCATGAAAATCGTATACTGGTCTGGTACCGGCAACAC

    TGAGAAAATGGCAGAGCTCATCGCTAAAGGTATCATCGAA

    TCTGGTAAAGACGTCAACACCATCAACGTGTCTGACGTTA

    ACATCGATGAACTGCTGAACGAAGATATCCTGATCCTGGG

    TTGCTCTGCCATGGGCGATGAAGTTCTCGAGGAAAGCGAA

    TTTGAACCGTTCATCGAAGAGATCTCTACCAAAATCTCTG

    GTAAGAAGGTTGCGCTGTTCGGTTCTTACGGTTGGGGCGA

    CGGTAAGTGGATGCGTGACTTCGAAGAACGTATGAACGGC

    TACGGTTGCGTTGTTGTTGAGACCCCGCTGATCGTTCAGA

    ACGAGCCGGACGAAGCTGAGCAGGACTGCATCGAATTTGG

    TAAGAAGATCGCGAACATCTAGTAGA

    > Protein sequence

    MKIVYWSGTGNTEKMAELIAKGIIESGKDVNTINVSDVNI

    DELLNEDILILGCSAMGDEVLEESEFEPFIEEISTKISGK

    KVALFGSYGWGDGKWMRDFEERMNGYGCVVVETPLIVQNE

    PDEAEQDCIEFGKKIANI

    DNA Protena

    Hugues Sicotte, NCBI

    54

  • Cromossomos humanos

    Fonte: wikipedia